HORDB

ID: hor004665
Uniprot ID: A2ZFY7
Protein name: Protein FLORAL ORGAN NUMBER2
Gene name: FON2
Organism: Oryza sativa subsp. indica (Rice)
Family: CLV3/ESR signal peptide family
Source: Plant
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Oryza sativa (species), Oryza (genus), Oryzinae (subtribe), Oryzeae (tribe), Oryzoideae (subfamily), BOP clade, Poaceae (family), Poales (order), commelinids, Petrosaviidae (subclass), Liliopsida, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0033612 receptor serine/threonine kinase binding
GO BP: GO:0030154 cell differentiation
GO CC: GO:0005576 extracellular region

Sequence: RVGLPGEFSGDQRPVPATSFDLVTEPKTKQPRGVKGTRRPSWSSWSSTASRSSPPPGRGAPSAAAAAELRSVPAGPDPMHHHGSPRRPEHARSTGRP
Length: 97
Propeptide: MGRLFLCLVVAWCWVALLLVAPVHGRVGLPGEFSGDQRPVPATSFDLVTEPKTKQPRGVKGTRRPSWSSWSSTASRSSPPPGRGAPSAAAAAELRSVPAGPDPMHHHGSPRRPEHARSTGRP
Signal peptide: MGRLFLCLVVAWCWVALLLVAPVHG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Probable extracellular signal that regulates meristem maintenance. May function as a putative ligand for a receptor complex including FON1. Regulates the size of the floral meristem and the number of floral organs.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004665_AF2.pdb

hor004665_ESM.pdb

Mass:	1194976	Formula:	C440H698N148O134S
Absent amino acids:	CINY	Common amino acids:	P
pI:	12.22	Basic residues:	19
Polar residues:	30	Hydrophobic residues:	22
Hydrophobicity:	-101.96	Boman Index:	-26640
Half-Life:	1 hour	Half-Life Yeast:	2 min
Half-Life E.Coli:	2 min	Aliphatic Index	37.32
Instability Index:	8840.31	Extinction Coefficient cystines:	11000
Absorbance 280nm:	114.58